PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g065490.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family TALE
Protein Properties Length: 625aa    MW: 69745.5 Da    PI: 6.966
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g065490.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.41.4e-094665031954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yps +++  LA+++gL+++qV +WF N R +
  Sopim02g065490.0.1 466 FEHflHPYPSDADKHLLARQTGLSKNQVANWFINARVR 503
                         664559******************************88 PP

2BELL88.57.3e-293403941872
                BELL  18 eVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         +VdkrY++y+eq+q+v++sF+ v+g g+a pYtslA ka+SrhF+cLkd +  q+
  Sopim02g065490.0.1 340 KVDKRYNHYCEQMQMVVNSFDLVMGFGAAVPYTSLAHKAMSRHFKCLKDGVGAQL 394
                         7*************************************************98886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.4E-53261392IPR006563POX domain
PfamPF075262.3E-37266390IPR006563POX domain
PROSITE profilePS5007112.552444507IPR001356Homeobox domain
SMARTSM003891.7E-9447511IPR001356Homeobox domain
CDDcd000864.87E-12447508No hitNo description
SuperFamilySSF466894.71E-17448514IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-28450513IPR009057Homeodomain-like
PfamPF059201.3E-17464503IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MSQEYHHQGL ASNEFERPQD QHHHQQQHIG QQIQQEKLRV EQGFEPRGGE SSGIQVYETD  60
GMLSEMFNFQ TTSTAAMTAT ELLQEQLSHS NQQPHHQPWF GNRQEIVVGG SLQVPFGDNT  120
KDDVNAKVLS NRDSVTAYYQ RQHNQVPSIS TTESMQLFLM NPQPNSPSQL STPSALHQGF  180
TSPVGGHFSQ FMCGGASTSS NPIGGVNVLD QGQGLSLSLS STLQHLEASK VEDLRMSSGG  240
EMLFFNQENQ NHHNISFGSS LGLVNVLRNS KYVKATQELL EEFCCVGKGQ LFKKINKVSR  300
NITSPTINPS GSNNNNSSSS KDIIPPNLST ADRLDHQRRK VDKRYNHYCE QMQMVVNSFD  360
LVMGFGAAVP YTSLAHKAMS RHFKCLKDGV GAQLKKTCEA LGEKDVSNTT SSGLTKGETP  420
RLKLLEQNLR QQRAFQQMGI VMEQEAWRPQ RGLPERSVNI LRAWLFEHFL HPYPSDADKH  480
LLARQTGLSK NQVANWFINA RVRLWKPMVE EMYQREANED DDMNSRNTQR PTPDITTTNS  540
KITETKSAAA TENDPSMNTH YSSSMQTQLN NSPTIQHESH RSGAEYDGTT DIGSKIMTFG  600
TTTPADVSLT LGLHHAGNLP HFYN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16453511563Homeobox protein Meis2
3k2a_B2e-16453511563Homeobox protein Meis2
4xrm_A3e-16453511563Homeobox protein Meis2
4xrm_B3e-16453511563Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004233410.10.0PREDICTED: BEL1-like homeodomain protein 2
RefseqXP_010317146.10.0PREDICTED: BEL1-like homeodomain protein 2
SwissprotQ94KL51e-131BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLK4B6Y10.0K4B6Y1_SOLLC; Uncharacterized protein
STRINGSolyc02g065490.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33412139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-129BEL1-like homeodomain 4